PDB entry 4xpb

View 4xpb on RCSB PDB site
Description: X-ray structure of Drosophila dopamine transporter with subsiteB mutations (D121G/S426M) bound to cocaine
Class: tranport protein/inhibitor
Keywords: integral membrane protein, all-alpha helical antidepressant complex, tranport protein-inhibitor complex
Deposited on 2015-01-16, released 2015-05-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transporter
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: DAT, CG8380, Dmel_CG8380
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7K4Y6
      • engineered mutation (54)
      • engineered mutation (101)
      • engineered mutation (352)
      • engineered mutation (363)
  • Chain 'H':
    Compound: antibody fragment light chain-protein, 9d5-light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XPB
  • Chain 'L':
    Compound: antibody fragment heavy chain-protein, 9d5-heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XPB (0-213)
    Domains in SCOPe 2.06: d4xpbl1, d4xpbl2
  • Heterogens: NA, COC, N9S, CLR, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xpbL (L:)
    envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne