PDB entry 4xpa

View 4xpa on RCSB PDB site
Description: X-ray structure of Drosophila dopamine transporter bound to 3,4dichlorophenethylamine
Class: transport protein/inhibitor
Keywords: integral membrane protein, all-alpha helical antidepressant complex, transport protein-inhibitor complex
Deposited on 2015-01-16, released 2015-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transporter
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: DAT, Dmel_CG8380
    Database cross-references and differences (RAF-indexed):
    • PDB 4XPA
  • Chain 'H':
    Compound: antibody fragment light chain-protein, 9d5-light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XPA
  • Chain 'L':
    Compound: antibody fragment heavy chain-protein, 9d5-heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XPA
    Domains in SCOPe 2.05: d4xpal1, d4xpal2
  • Heterogens: CLR, 42J, CL, NA, N9S, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4xpaL (L:)
    mdfqvqifsfllisasvamsrgenvltqspaimstspgekvtmtcrasssvgssylhwyq
    qksgaspklwiystsnlasgvparfsgsgsgtsysltissveaedaatyycqqfsgyplt
    fgsgtklemkradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqn
    gvlnswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xpaL (L:)
    envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne