PDB entry 4xp9

View 4xp9 on RCSB PDB site
Description: X-ray structure of Drosophila dopamine transporter bound to psychostimulant D-amphetamine
Class: transport protein/inhibitor
Keywords: integral membrane protein, all-alpha helical antidepressant complex, membrane protein, protein transport, transport protein-inhibitor complex
Deposited on 2015-01-16, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Transporter
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: DAT, CG8380, Dmel_CG8380
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B4KEX2 (0-535)
      • engineered mutation (49)
      • engineered mutation (349)
      • expression tag (536)
  • Chain 'H':
    Compound: antibody fragment light chain-protein, 9d5-light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XP9 (0-218)
  • Chain 'L':
    Compound: antibody fragment heavy chain-protein, 9d5-heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XP9 (0-212)
    Domains in SCOPe 2.06: d4xp9l1, d4xp9l2
  • Heterogens: Y01, NAG, MAL, MPO, CLR, 1WE, P4G, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xp9L (L:)
    envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkiegserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrn