PDB entry 4xp4

View 4xp4 on RCSB PDB site
Description: X-ray structure of Drosophila dopamine transporter in complex with cocaine
Class: transport protein/inhibitor
Keywords: integral membrane protein, all-alpha helical antidepressant complex, membrane protein-tranport protein complex, transport protein-inhibitor complex
Deposited on 2015-01-16, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dopamine transporter
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: DAT, CG8380, Dmel_CG8380
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7K4Y6
      • engineered mutation (54)
      • engineered mutation (354)
  • Chain 'H':
    Compound: antibody fragment heavy chain-protein, 9d5-light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XP4
  • Chain 'L':
    Compound: antibody fragment heavy chain-protein, 9d5-heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XP4
    Domains in SCOPe 2.06: d4xp4l1, d4xp4l2
  • Heterogens: Y01, P4G, MAL, CLR, COC, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4xp4L (L:)
    mdfqvqifsfllisasvamsrgenvltqspaimstspgekvtmtcrasssvgssylhwyq
    qksgaspklwiystsnlasgvparfsgsgsgtsysltissveaedaatyycqqfsgyplt
    fgsgtklemkradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqn
    gvlnswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xp4L (L:)
    envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne