PDB entry 4xp1

View 4xp1 on RCSB PDB site
Description: X-ray structure of Drosophila dopamine transporter bound to neurotransmitter dopamine
Class: membrane protein/transport protein
Keywords: integral membrane protein, membrane protein-transport protein complex
Deposited on 2015-01-16, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dopamine transporter, isoform B
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: DAT, Dmel_CG8380
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B4KEX2 (0-534)
      • engineered mutation (49)
      • engineered mutation (349)
  • Chain 'H':
    Compound: Antibody fragment Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XP1 (0-218)
  • Chain 'L':
    Compound: Antibody fragment Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XP1 (0-213)
    Domains in SCOPe 2.06: d4xp1l1, d4xp1l2
  • Heterogens: NA, CL, MAL, NAG, P4G, LDP, EDO, Y01, CLR, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xp1L (L:)
    envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne