PDB entry 4xoi

View 4xoi on RCSB PDB site
Description: Structure of hsAnillin bound with RhoA(Q63L) at 2.1 Angstroms resolution
Class: cell cycle
Keywords: RhoA-anillin complex
Deposited on 2015-01-16, released 2015-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOA, ARH12, ARHA, RHO12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61586 (Start-179)
      • conflict (24)
      • engineered mutation (62)
    Domains in SCOPe 2.05: d4xoia_
  • Chain 'B':
    Compound: actin-binding protein anillin
    Species: Homo sapiens [TaxId:9606]
    Gene: ANLN
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOA, ARH12, ARHA, RHO12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61586 (Start-179)
      • conflict (24)
      • engineered mutation (62)
    Domains in SCOPe 2.05: d4xoic_
  • Chain 'D':
    Compound: actin-binding protein anillin
    Species: Homo sapiens [TaxId:9606]
    Gene: ANLN
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xoiA (A:)
    maairkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdt
    agledydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xoiA (A:)
    irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagl
    edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
    dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xoiC (C:)
    maairkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdt
    agledydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xoiC (C:)
    irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagl
    edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
    dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    

  • Chain 'D':
    No sequence available.