PDB entry 4xnu

View 4xnu on RCSB PDB site
Description: X-ray structure of Drosophila dopamine transporter in complex with nisoxetine
Class: transport protein/inhibitor
Keywords: integral membrane protein, all-alpha helical antidepressant complex, transport protein-inhibitor complex
Deposited on 2015-01-16, released 2015-05-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integral membrane protein-dopamine transporter
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XNU (0-531)
  • Chain 'H':
    Compound: Antibody fragment Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XNU
  • Chain 'L':
    Compound: Antibody fragment Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XNU (0-213)
    Domains in SCOPe 2.05: d4xnul1, d4xnul2
  • Heterogens: NA, CL, CLR, 41U, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xnuL (L:)
    envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne