PDB entry 4xm4

View 4xm4 on RCSB PDB site
Description: Structure of Chaetomium Mex67:Mtr2 subunits
Class: transport protein
Keywords: nuclear transport, mRNA export, transport protein
Deposited on 2015-01-14, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mex67
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Gene: CTHT_0059630
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Mex67
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Gene: CTHT_0059630
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Mex67
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Gene: CTHT_0059630
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xm4c_
  • Chain 'D':
    Compound: Mex67
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Gene: CTHT_0059630
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xm4d_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xm4C (C:)
    smpalssqsklsqaaqetkqkltsclarrynaeqklldlsalgtdetlsslgsfnnqsla
    eksfkalmhlvsneykdpeqkneaiqavslarndildvgqvyslavtlprlrrldlsgnn
    lenlskiskwqqefrfleelhltgnpvttlpnyateikkwfpslqildgqqirtpqeaae
    slkssfptplpqlpsnvrdgennvastflqaffqlwdhdrltlipqfydsettfsvvfat
    dspqdpassscskfsrnlnilsprhpstlqrlfvgsnliadlwkvlpatrhpsldqtsqw
    lidchtfphladptgmapyamglminvngqceeadisqnlygtrtfsrcfilgpskpgap
    hpyrvlsdqltlhtwkpqpapqvgtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xm4C (C:)
    clarrynaeqklldlsalgtdksfkalmhlvsneykdpeqkneaiqavslarndildvgq
    vyslavtlprlrrldlsgnnlenlskiskwqqefrfleelhltgnpvttlpnyateikkw
    fpslqildgqqirtpqeaaeslkssfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xm4D (D:)
    smpalssqsklsqaaqetkqkltsclarrynaeqklldlsalgtdetlsslgsfnnqsla
    eksfkalmhlvsneykdpeqkneaiqavslarndildvgqvyslavtlprlrrldlsgnn
    lenlskiskwqqefrfleelhltgnpvttlpnyateikkwfpslqildgqqirtpqeaae
    slkssfptplpqlpsnvrdgennvastflqaffqlwdhdrltlipqfydsettfsvvfat
    dspqdpassscskfsrnlnilsprhpstlqrlfvgsnliadlwkvlpatrhpsldqtsqw
    lidchtfphladptgmapyamglminvngqceeadisqnlygtrtfsrcfilgpskpgap
    hpyrvlsdqltlhtwkpqpapqvgtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xm4D (D:)
    tkqkltsclarrynaeqklldlsalgtdetslaeksfkalmhlvsneykdpeqkneaiqa
    vslarndildvgqvyslavtlprlrrldlsgnnlenlskiskwqqefrfleelhltgnpv
    ttlpnyateikkwfpslqildgqqirtpqeaaeslks