PDB entry 4xlt

View 4xlt on RCSB PDB site
Description: Crystal structure of response regulator receiver protein from Dyadobacter fermentans DSM 18053
Class: signaling protein
Keywords: PSI-BIOLOGY, response regulator, Structural Genomics, Midwest Center for Structural Genomics, MCSG, SIGNALING PROTEIN
Deposited on 2015-01-13, released 2015-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver protein
    Species: Dyadobacter fermentans (strain ATCC 700827 / DSM 18053 / NS114) [TaxId:471854]
    Gene: Dfer_0154
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6VVW9 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d4xlta1, d4xlta2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xltA (A:)
    snamdfiivddsvfdlftqeklllksglttsvrtfnsaqaaidhlrsqgadipdtvilld
    lqmpgingfeftehygmlpeavrarirlfmisstvdisdieqaeanphiiqllpkpleip
    llrellkrwfpsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xltA (A:)
    amdfiivddsvfdlftqeklllksglttsvrtfnsaqaaidhlrsqgadipdtvilldlq
    mingfeftehygmlpeavrarirlfmisstvdisdieqaeanphiiqllpkpleipllre
    llkrwfps