PDB entry 4xjq

View 4xjq on RCSB PDB site
Description: The catalytic mechanism of human parainfluenza virus type 3 haemagglutinin-neuraminidase revealed
Class: hydrolase
Keywords: Hydrolase, Human Parainfluenza Virus 3 Haemagglutinin-Neuraminidase, viral envelope protein
Deposited on 2015-01-09, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjqa_
  • Chain 'B':
    Compound: hemagglutinin-neuraminidase
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjqb_
  • Heterogens: CA, NAG, BMA, MAN, EDO, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xjqA (A:)
    iseitirndnqevppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllamp
    ttvdgcvrtpslvindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnpris
    htfnindnrkscslallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrf
    knnnisfdqpyaalypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcn
    qashspwfsdrrmvnsiivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytr
    stswhsklqlgiiditdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdaypl
    nptgsivssvildsqksrvnpvitystatervnelairnktlsagytttscithynkgyc
    fhiveinhksldtfqpmlfkteipkscshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjqA (A:)
    rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind
    liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal
    lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp
    svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns
    iivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiidit
    dysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqk
    srvnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqp
    mlfkteipkscs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xjqB (B:)
    iseitirndnqevppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllamp
    ttvdgcvrtpslvindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnpris
    htfnindnrkscslallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrf
    knnnisfdqpyaalypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcn
    qashspwfsdrrmvnsiivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytr
    stswhsklqlgiiditdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdaypl
    nptgsivssvildsqksrvnpvitystatervnelairnktlsagytttscithynkgyc
    fhiveinhksldtfqpmlfkteipkscshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjqB (B:)
    vppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpsl
    vindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrksc
    slallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpya
    alypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrr
    mvnsiivvdkgsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiid
    itdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvilds
    qksrvnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtf
    qpmlfkteipkscs