PDB entry 4xhu

View 4xhu on RCSB PDB site
Description: The complex structure of Timeless_PAB and PARP-1_catalytic domain
Class: transferase/replication
Keywords: DNA damage response, TRANSFERASE-REPLICATION complex
Deposited on 2015-01-06, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP1, ADPRT, PPOL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xhua1, d4xhua2
  • Chain 'B':
    Compound: Protein timeless homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: TIMELESS, TIM, TIM1, TIMELESS1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP1, ADPRT, PPOL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xhuc1, d4xhuc2
  • Chain 'D':
    Compound: Protein timeless homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: TIMELESS, TIM, TIM1, TIMELESS1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, ACT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xhuA (A:)
    gpghmtksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilse
    vqqavsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievay
    sllrggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevid
    ifkieregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgi
    yfadmvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgktt
    pdpsanisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfktslw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xhuA (A:)
    tksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqav
    sqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrsskdpid
    vnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpf
    kqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychts
    qgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvpl
    gtgissgvndtsllyneyivydiaqvnlkyllklkfnfkts
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xhuC (C:)
    gpghmtksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilse
    vqqavsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievay
    sllrggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevid
    ifkieregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgi
    yfadmvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgktt
    pdpsanisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfktslw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xhuC (C:)
    lpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsqss
    dsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrsskdpi
    dvnyeklktdikvvdrdseeaeiirkyvknthaydlevidifkieregecqrykpfkqlh
    nrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdp
    iglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgi
    ssgvdtsllyneyivydiaqvnlkyllklkfnf
    

  • Chain 'D':
    No sequence available.