PDB entry 4xdd

View 4xdd on RCSB PDB site
Description: Apo [FeFe]-Hydrogenase CpI
Class: oxidoreductase
Keywords: CpI, FeFe-Hydrogenase, oxidoreductase
Deposited on 2014-12-19, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron hydrogenase 1
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29166 (0-573)
      • expression tag (574-581)
    Domains in SCOPe 2.07: d4xdda1, d4xdda2, d4xdda3, d4xdda4
  • Chain 'B':
    Compound: Iron hydrogenase 1
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29166 (0-573)
      • expression tag (574-580)
    Domains in SCOPe 2.07: d4xddb1, d4xddb2, d4xddb3, d4xddb4
  • Heterogens: SF4, MG, FES, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xddA (A:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykksawshpqfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xddA (A:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykksawshpqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xddB (B:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykksawshpqfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xddB (B:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykksawshpq