PDB entry 4xcc

View 4xcc on RCSB PDB site
Description: Crystal structure of human 4E10 Fab crystalized in the presence of Phosphatidylcholine (06:0 PC); I422 space group
Class: immune system
Keywords: 4E10 Fab anti HIV-1 gp41, lipid membrane, immune system, Phosphatidylcholine
Deposited on 2014-12-17, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 4E10 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XCC (0-229)
  • Chain 'L':
    Compound: 4E10 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XCC (0-End)
    Domains in SCOPe 2.07: d4xccl1, d4xccl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4xccL (L:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xccL (L:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge