PDB entry 4x9q

View 4x9q on RCSB PDB site
Description: MnSOD-3 Room Temperature Structure
Class: oxidoreductase
Keywords: Superoxide, Manganese, Oxidoreductase, Dismutase
Deposited on 2014-12-11, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn] 2, mitochondrial
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: sod-3, C08A9.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x9qa1, d4x9qa2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn] 2, mitochondrial
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: sod-3, C08A9.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x9qc1, d4x9qc2
  • Heterogens: MN, MLI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4x9qA (A:)
    khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial
    qpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqgs
    gwgwlgyckkdkilkiatcanqdplegmvplfgidvwehayylqyknvrpdyvhaiwkia
    nwkniserfanarq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4x9qC (C:)
    khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial
    qpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqgs
    gwgwlgyckkdkilkiatcanqdplegmvplfgidvwehayylqyknvrpdyvhaiwkia
    nwkniserfanarq