PDB entry 4x80

View 4x80 on RCSB PDB site
Description: Crystal Structure of murine 7B4 Fab monoclonal antibody against ADAMTS5
Class: immune system
Keywords: monoclonal, IMMUNE SYSTEM
Deposited on 2014-12-09, released 2015-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: IgG1 7B4 FAB Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X80 (0-223)
  • Chain 'L':
    Compound: IgG1 7B4 FAB Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X80 (0-212)
    Domains in SCOPe 2.05: d4x80l1, d4x80l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4x80L (L:)
    diqmtqspaslsasvgetvtitcrtseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyscqhkygtpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne