PDB entry 4x7s

View 4x7s on RCSB PDB site
Description: Structure of omalizumab Fab fragment crystal form 1
Class: immune system
Keywords: Antibody Fab Fragment, Anti-IgE Antibody, Anti-inflammatory, immune system
Deposited on 2014-12-09, released 2015-03-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Epididymis luminal protein 214
    Species: Homo sapiens [TaxId:9606]
    Gene: HEL-214
    Database cross-references and differences (RAF-indexed):
    • PDB 4X7S (0-221)
  • Chain 'L':
    Compound: Ig kappa chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • PDB 4X7S (0-217)
    Domains in SCOPe 2.05: d4x7sl1, d4x7sl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4x7sL (L:)
    diqltqspsslsasvgdrvtitcrasqsvdydgdsymnwyqqkpgkapklliyaasyles
    gvpsrfsgsgsgtdftltisslqpedfatyycqqshedpytfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec