PDB entry 4x57

View 4x57 on RCSB PDB site
Description: Structure of an Arabidopsis E2 / Membrane-anchored Ubiquitin-fold Protein Complex
Class: ligase/protein binding
Keywords: Ubiquitin, Ubconjugating (E2) enzymes, Membrane anchored, Ubiquitin-fold protein 3, MUB3, E1:E2 Complex, ligase-protein binding complex
Deposited on 2014-12-04, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 8
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: UBC8, UBC4A, At5g41700, MBK23.24
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35131 (31-End)
      • expression tag (30)
    Domains in SCOPe 2.07: d4x57a1, d4x57a2
  • Chain 'B':
    Compound: Membrane-anchored ubiquitin-fold protein 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: MUB3, At4g24990, F13M23.130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x57b_
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2 8
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: UBC8, UBC4A, At5g41700, MBK23.24
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35131 (31-178)
      • expression tag (30)
    Domains in SCOPe 2.07: d4x57c1, d4x57c2
  • Chain 'D':
    Compound: Membrane-anchored ubiquitin-fold protein 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: MUB3, At4g24990, F13M23.130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x57d_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x57A (A:)
    mgsshhhhhhgtgsyitslykkagsaaapftmaskrilkelkdlqkdpptscsagpvaed
    mfhwqatimgpaespysggvflvtihfppdypfkppkvafrtkvfhpninsngsicldil
    keqwspaltiskvllsicslltdpnpddplvpeiahmyktdrakyeatarnwtqkyamg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x57A (A:)
    tmaskrilkelkdlqkdpptscsagpvaedmfhwqatimgpaespysggvflvtihfppd
    ypfkppkvafrtkvfhpninsngsicldilkeqwspaltiskvllsicslltdpnpddpl
    vpeiahmyktdrakyeatarnwtqkyam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x57B (B:)
    mgsshhhhhhssglvprgshmpeeesidikfrlydgsdigpfrysaastvdflkqrvvsd
    wpkgktvvpkginevklissgkilennktvgqcktpfgdiaggvivmhvvvqpslakskt
    ekkvdkapkavictctil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x57B (B:)
    peeesidikfrlydgsdigpfrysaastvdflkqrvvsdwpkgktvvpkginevklissg
    kilennktvgqcktpfgdiaggvivmhvvvqps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x57C (C:)
    mgsshhhhhhgtgsyitslykkagsaaapftmaskrilkelkdlqkdpptscsagpvaed
    mfhwqatimgpaespysggvflvtihfppdypfkppkvafrtkvfhpninsngsicldil
    keqwspaltiskvllsicslltdpnpddplvpeiahmyktdrakyeatarnwtqkyamg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x57C (C:)
    tmaskrilkelkdlqkdpptscsagpvaedmfhwqatimgpaespysggvflvtihfppd
    ypfkppkvafrtkvfhpninsngsicldilkeqwspaltiskvllsicslltdpnpddpl
    vpeiahmyktdrakyeatarnwtqkyamg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x57D (D:)
    mgsshhhhhhssglvprgshmpeeesidikfrlydgsdigpfrysaastvdflkqrvvsd
    wpkgktvvpkginevklissgkilennktvgqcktpfgdiaggvivmhvvvqpslakskt
    ekkvdkapkavictctil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x57D (D:)
    eeesidikfrlydgsdigpfrysaastvdflkqrvvsdwpkgktvvpkginevklissgk
    ilennktvgqcktpfgdiaggvivmhvvvqps