PDB entry 4x4z

View 4x4z on RCSB PDB site
Description: Retrofitting antibodies with stabilizing mutations. Herceptin VL mutant F53D.
Class: immune system
Keywords: antibody stabilization mutations, IMMUNE SYSTEM
Deposited on 2014-12-04, released 2015-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Herceptin VL domain with F53D mutation
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X4Z (Start-106)
    Domains in SCOPe 2.07: d4x4za_
  • Chain 'B':
    Compound: Herceptin VL domain with F53D mutation
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X4Z (Start-106)
    Domains in SCOPe 2.07: d4x4zb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x4zA (A:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasdlysgvps
    rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x4zA (A:)
    iqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasdlysgvpsr
    fsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x4zB (B:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasdlysgvps
    rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x4zB (B:)
    iqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasdlysgvpsr
    fsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik