PDB entry 4x4x

View 4x4x on RCSB PDB site
Description: Retrofitting antibodies with stabilizing mutations. Herceptin scFv mutant.
Class: immune system
Keywords: antibody stabilization mutations, IMMUNE SYSTEM
Deposited on 2014-12-04, released 2015-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Human Variable Heavy Chain of Herceptin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X4X
    Domains in SCOPe 2.07: d4x4xa_
  • Chain 'B':
    Compound: Human Variable Light Chain of Herceptin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X4X (0-End)
    Domains in SCOPe 2.07: d4x4xb_
  • Chain 'C':
    Compound: Human Variable Heavy Chain of Herceptin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X4X
    Domains in SCOPe 2.07: d4x4xc_
  • Chain 'D':
    Compound: Human Variable Light Chain of Herceptin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X4X (0-End)
    Domains in SCOPe 2.07: d4x4xd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x4xA (A:)
    fastevqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptng
    ytryadsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdvwgqgtlv
    tvssggggsggggsggggst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x4xA (A:)
    vqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytrya
    dsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x4xB (B:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysadflysgvps
    rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x4xB (B:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysadflysgvps
    rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkvei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x4xC (C:)
    fastevqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptng
    ytryadsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdvwgqgtlv
    tvssggggsggggsggggst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x4xC (C:)
    vqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytrya
    dsvkgrftisadtskntaylqmnslraedtavyycsrwamdvwgqgtlvtvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x4xD (D:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysadflysgvps
    rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x4xD (D:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkkapklliysadflrfsgsrsg
    tdftltisslqpedfatyycqqhyttpptfgqgtkvei