PDB entry 4x46

View 4x46 on RCSB PDB site
Description: X-RAY structure thymidine phosphorylase from Salmonella typhimurium complex with SO4 at 2.19 A
Class: transferase
Keywords: thymidine phosphorylase, nucleoside, metabolism, transferase
Deposited on 2014-12-02, released 2015-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: deoA, STM4568
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x46a1, d4x46a2, d4x46a3
  • Chain 'B':
    Compound: thymidine phosphorylase
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: deoA, STM4568
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x46b1, d4x46b2, d4x46b3
  • Heterogens: EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4x46A (A:)
    mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglght
    ggtldkleaipgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsi
    plitgsilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearakl
    qavldngkaaevfgrmvaaqkgpsdfvenydkylptamlskavyadtegfisamdtralg
    mavvsmgggrrqasdtidysvgftdmarlgdsidgqrplavihakdeaswqeaakavkaa
    iilddkapastpsvyrrite
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4x46B (B:)
    mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglght
    ggtldkleaipgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsi
    plitgsilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearakl
    qavldngkaaevfgrmvaaqkgpsdfvenydkylptamlskavyadtegfisamdtralg
    mavvsmgggrrqasdtidysvgftdmarlgdsidgqrplavihakdeaswqeaakavkaa
    iilddkapastpsvyrrite