PDB entry 4x42

View 4x42 on RCSB PDB site
Description: Crystal structure of DEN4 ED3 mutant with epitope two residues substituted from DEN3 ED3
Class: structural protein, immune system
Keywords: Sero-specificity, Epitope graft mutants, ELISA, STRUCTURAL PROTEIN, IMMUNE SYSTEM
Deposited on 2014-12-02, released 2015-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Dengue virus type 4 [TaxId:408871]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09866
      • engineered mutation (90-91)
      • engineered mutation (94)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4x42a_
  • Chain 'B':
    Compound: Envelope protein E
    Species: Dengue virus type 4 [TaxId:408871]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09866 (2-End)
      • expression tag (1)
      • engineered mutation (90-91)
      • engineered mutation (94)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4x42b1, d4x42b2
  • Chain 'C':
    Compound: Envelope protein E
    Species: Dengue virus type 4 [TaxId:408871]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09866
      • engineered mutation (90-91)
      • engineered mutation (94)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4x42c_
  • Chain 'D':
    Compound: Envelope protein E
    Species: Dengue virus type 4 [TaxId:408871]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09866 (2-End)
      • expression tag (1)
      • engineered mutation (90-91)
      • engineered mutation (94)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4x42d1, d4x42d2
  • Chain 'E':
    Compound: Envelope protein E
    Species: Dengue virus type 4 [TaxId:408871]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09866
      • engineered mutation (90-91)
      • engineered mutation (94)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4x42e_
  • Chain 'F':
    Compound: Envelope protein E
    Species: Dengue virus type 4 [TaxId:408871]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09866 (2-End)
      • expression tag (1)
      • engineered mutation (90-91)
      • engineered mutation (94)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4x42f1, d4x42f2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x42A (A:)
    gsgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriis
    stplaentnsvtnieleppfgdsyivigvgdkalklnwfrkgssigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x42A (A:)
    sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
    aentnsvtnieleppfgdsyivigvgdkalklnwfrkgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x42B (B:)
    gsgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriis
    stplaentnsvtnieleppfgdsyivigvgdkalklnwfrkgssigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x42B (B:)
    sgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriiss
    tplaentnsvtnieleppfgdsyivigvgdkalklnwfrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x42C (C:)
    gsgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriis
    stplaentnsvtnieleppfgdsyivigvgdkalklnwfrkgssigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x42C (C:)
    sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
    aentnsvtnieleppfgdsyivigvgdkalklnwfrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x42D (D:)
    gsgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriis
    stplaentnsvtnieleppfgdsyivigvgdkalklnwfrkgssigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x42D (D:)
    sgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriiss
    tplaentnsvtnieleppfgdsyivigvgdkalklnwfrkgs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4x42E (E:)
    gsgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriis
    stplaentnsvtnieleppfgdsyivigvgdkalklnwfrkgssigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x42E (E:)
    ytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpla
    entnsvtnieleppfgdsyivigvgdkalklnwfrk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4x42F (F:)
    gsgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriis
    stplaentnsvtnieleppfgdsyivigvgdkalklnwfrkgssigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x42F (F:)
    sgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriiss
    tplaentnsvtnieleppfgdsyivigvgdkalklnwfrk