PDB entry 4x0v

View 4x0v on RCSB PDB site
Description: Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32
Class: hydrolase
Keywords: hydrolase, glycosidase, lichenase
Deposited on 2014-11-24, released 2015-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-1,3-1,4-glucanase
    Species: Caldicellulosiruptor sp. F32 [TaxId:1214564]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0va_
  • Chain 'B':
    Compound: Beta-1,3-1,4-glucanase
    Species: Caldicellulosiruptor sp. F32 [TaxId:1214564]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0vb_
  • Chain 'C':
    Compound: Beta-1,3-1,4-glucanase
    Species: Caldicellulosiruptor sp. F32 [TaxId:1214564]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0vc_
  • Chain 'D':
    Compound: Beta-1,3-1,4-glucanase
    Species: Caldicellulosiruptor sp. F32 [TaxId:1214564]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0vd_
  • Chain 'E':
    Compound: Beta-1,3-1,4-glucanase
    Species: Caldicellulosiruptor sp. F32 [TaxId:1214564]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0ve_
  • Chain 'F':
    Compound: Beta-1,3-1,4-glucanase
    Species: Caldicellulosiruptor sp. F32 [TaxId:1214564]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0vf_
  • Chain 'G':
    Compound: Beta-1,3-1,4-glucanase
    Species: Caldicellulosiruptor sp. F32 [TaxId:1214564]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0vg_
  • Chain 'H':
    Compound: Beta-1,3-1,4-glucanase
    Species: Caldicellulosiruptor sp. F32 [TaxId:1214564]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0vh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x0vA (A:)
    mrgshhhhhhgmaslnressnrakipeikiasrkipnnaalkfvkdmkigwnlgntfdaa
    fenpsfddellyetawcgvkttkqmidtvkkagfntiripvswhnhvtgsnftiskrwld
    rvqqvvdyamknkmyviinihhdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndh
    lifeavneprltgsrfewwldmnnpecrdaveainklnqvfvdtvrstggnnvsrylmvp
    gyaaapeyvlidefkipkdsskyknriiisvhayrpynfalqapnesgsvsewsvnsees
    rrdidyfmdklydkfvskgipvvigefgardkngnlqsrvefaayyvraarargitccww
    dnnafygngenfglldrktlkwvypeivsammkyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0vA (A:)
    rakipeikiasrkipnnaalkfvkdmkigwnlgntfdaafenpsfddellyetawcgvkt
    tkqmidtvkkagfntiripvswhnhvtgsnftiskrwldrvqqvvdyamknkmyviinih
    hdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndhlifeavneprltgsrfewwld
    mnnpecrdaveainklnqvfvdtvrstggnnvsrylmvpgyaaapeyvlidefkipkdss
    kyknriiisvhayrpynfalqapnesgsvsewsvnseesrrdidyfmdklydkfvskgip
    vvigefgardkngnlqsrvefaayyvraarargitccwwdnnafygngenfglldrktlk
    wvypeivsammkyar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x0vB (B:)
    mrgshhhhhhgmaslnressnrakipeikiasrkipnnaalkfvkdmkigwnlgntfdaa
    fenpsfddellyetawcgvkttkqmidtvkkagfntiripvswhnhvtgsnftiskrwld
    rvqqvvdyamknkmyviinihhdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndh
    lifeavneprltgsrfewwldmnnpecrdaveainklnqvfvdtvrstggnnvsrylmvp
    gyaaapeyvlidefkipkdsskyknriiisvhayrpynfalqapnesgsvsewsvnsees
    rrdidyfmdklydkfvskgipvvigefgardkngnlqsrvefaayyvraarargitccww
    dnnafygngenfglldrktlkwvypeivsammkyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0vB (B:)
    rakipeikiasrkipnnaalkfvkdmkigwnlgntfdaafenpsfddellyetawcgvkt
    tkqmidtvkkagfntiripvswhnhvtgsnftiskrwldrvqqvvdyamknkmyviinih
    hdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndhlifeavneprltgsrfewwld
    mnnpecrdaveainklnqvfvdtvrstggnnvsrylmvpgyaaapeyvlidefkipkdss
    kyknriiisvhayrpynfalqapnesgsvsewsvnseesrrdidyfmdklydkfvskgip
    vvigefgardkngnlqsrvefaayyvraarargitccwwdnnafygngenfglldrktlk
    wvypeivsammkyar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x0vC (C:)
    mrgshhhhhhgmaslnressnrakipeikiasrkipnnaalkfvkdmkigwnlgntfdaa
    fenpsfddellyetawcgvkttkqmidtvkkagfntiripvswhnhvtgsnftiskrwld
    rvqqvvdyamknkmyviinihhdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndh
    lifeavneprltgsrfewwldmnnpecrdaveainklnqvfvdtvrstggnnvsrylmvp
    gyaaapeyvlidefkipkdsskyknriiisvhayrpynfalqapnesgsvsewsvnsees
    rrdidyfmdklydkfvskgipvvigefgardkngnlqsrvefaayyvraarargitccww
    dnnafygngenfglldrktlkwvypeivsammkyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0vC (C:)
    nrakipeikiasrkipnnaalkfvkdmkigwnlgntfdaafenpsfddellyetawcgvk
    ttkqmidtvkkagfntiripvswhnhvtgsnftiskrwldrvqqvvdyamknkmyviini
    hhdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndhlifeavneprltgsrfewwl
    dmnnpecrdaveainklnqvfvdtvrstggnnvsrylmvpgyaaapeyvlidefkipkds
    skyknriiisvhayrpynfalqapnesgsvsewsvnseesrrdidyfmdklydkfvskgi
    pvvigefgardkngnlqsrvefaayyvraarargitccwwdnnafygngenfglldrktl
    kwvypeivsammkyar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x0vD (D:)
    mrgshhhhhhgmaslnressnrakipeikiasrkipnnaalkfvkdmkigwnlgntfdaa
    fenpsfddellyetawcgvkttkqmidtvkkagfntiripvswhnhvtgsnftiskrwld
    rvqqvvdyamknkmyviinihhdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndh
    lifeavneprltgsrfewwldmnnpecrdaveainklnqvfvdtvrstggnnvsrylmvp
    gyaaapeyvlidefkipkdsskyknriiisvhayrpynfalqapnesgsvsewsvnsees
    rrdidyfmdklydkfvskgipvvigefgardkngnlqsrvefaayyvraarargitccww
    dnnafygngenfglldrktlkwvypeivsammkyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0vD (D:)
    rakipeikiasrkipnnaalkfvkdmkigwnlgntfdaafenpsfddellyetawcgvkt
    tkqmidtvkkagfntiripvswhnhvtgsnftiskrwldrvqqvvdyamknkmyviinih
    hdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndhlifeavneprltgsrfewwld
    mnnpecrdaveainklnqvfvdtvrstggnnvsrylmvpgyaaapeyvlidefkipkdss
    kyknriiisvhayrpynfalqapnesgsvsewsvnseesrrdidyfmdklydkfvskgip
    vvigefgardkngnlqsrvefaayyvraarargitccwwdnnafygngenfglldrktlk
    wvypeivsammkyar
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4x0vE (E:)
    mrgshhhhhhgmaslnressnrakipeikiasrkipnnaalkfvkdmkigwnlgntfdaa
    fenpsfddellyetawcgvkttkqmidtvkkagfntiripvswhnhvtgsnftiskrwld
    rvqqvvdyamknkmyviinihhdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndh
    lifeavneprltgsrfewwldmnnpecrdaveainklnqvfvdtvrstggnnvsrylmvp
    gyaaapeyvlidefkipkdsskyknriiisvhayrpynfalqapnesgsvsewsvnsees
    rrdidyfmdklydkfvskgipvvigefgardkngnlqsrvefaayyvraarargitccww
    dnnafygngenfglldrktlkwvypeivsammkyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0vE (E:)
    akipeikiasrkipnnaalkfvkdmkigwnlgntfdaafenpsfddellyetawcgvktt
    kqmidtvkkagfntiripvswhnhvtgsnftiskrwldrvqqvvdyamknkmyviinihh
    dimpgyyypnsqhlqtsikyvksiwtqvatrfknyndhlifeavneprltgsrfewwldm
    nnpecrdaveainklnqvfvdtvrstggnnvsrylmvpgyaaapeyvlidefkipkdssk
    yknriiisvhayrpynfalqapnesgsvsewsvnseesrrdidyfmdklydkfvskgipv
    vigefgardkngnlqsrvefaayyvraarargitccwwdnnafygngenfglldrktlkw
    vypeivsammkya
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4x0vF (F:)
    mrgshhhhhhgmaslnressnrakipeikiasrkipnnaalkfvkdmkigwnlgntfdaa
    fenpsfddellyetawcgvkttkqmidtvkkagfntiripvswhnhvtgsnftiskrwld
    rvqqvvdyamknkmyviinihhdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndh
    lifeavneprltgsrfewwldmnnpecrdaveainklnqvfvdtvrstggnnvsrylmvp
    gyaaapeyvlidefkipkdsskyknriiisvhayrpynfalqapnesgsvsewsvnsees
    rrdidyfmdklydkfvskgipvvigefgardkngnlqsrvefaayyvraarargitccww
    dnnafygngenfglldrktlkwvypeivsammkyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0vF (F:)
    akipeikiasrkipnnaalkfvkdmkigwnlgntfdaafenpsfddellyetawcgvktt
    kqmidtvkkagfntiripvswhnhvtgsnftiskrwldrvqqvvdyamknkmyviinihh
    dimpgyyypnsqhlqtsikyvksiwtqvatrfknyndhlifeavneprltgsrfewwldm
    nnpecrdaveainklnqvfvdtvrstggnnvsrylmvpgyaaapeyvlidefkipkdssk
    yknriiisvhayrpynfalqapnesgsvsewsvnseesrrdidyfmdklydkfvskgipv
    vigefgardkngnlqsrvefaayyvraarargitccwwdnnafygngenfglldrktlkw
    vypeivsammkyar
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4x0vG (G:)
    mrgshhhhhhgmaslnressnrakipeikiasrkipnnaalkfvkdmkigwnlgntfdaa
    fenpsfddellyetawcgvkttkqmidtvkkagfntiripvswhnhvtgsnftiskrwld
    rvqqvvdyamknkmyviinihhdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndh
    lifeavneprltgsrfewwldmnnpecrdaveainklnqvfvdtvrstggnnvsrylmvp
    gyaaapeyvlidefkipkdsskyknriiisvhayrpynfalqapnesgsvsewsvnsees
    rrdidyfmdklydkfvskgipvvigefgardkngnlqsrvefaayyvraarargitccww
    dnnafygngenfglldrktlkwvypeivsammkyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0vG (G:)
    akipeikiasrkipnnaalkfvkdmkigwnlgntfdaafenpsfddellyetawcgvktt
    kqmidtvkkagfntiripvswhnhvtgsnftiskrwldrvqqvvdyamknkmyviinihh
    dimpgyyypnsqhlqtsikyvksiwtqvatrfknyndhlifeavneprltgsrfewwldm
    nnpecrdaveainklnqvfvdtvrstggnnvsrylmvpgyaaapeyvlidefkipkdssk
    yknriiisvhayrpynfalqapnesgsvsewsvnseesrrdidyfmdklydkfvskgipv
    vigefgardkngnlqsrvefaayyvraarargitccwwdnnafygngenfglldrktlkw
    vypeivsammkyar
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4x0vH (H:)
    mrgshhhhhhgmaslnressnrakipeikiasrkipnnaalkfvkdmkigwnlgntfdaa
    fenpsfddellyetawcgvkttkqmidtvkkagfntiripvswhnhvtgsnftiskrwld
    rvqqvvdyamknkmyviinihhdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndh
    lifeavneprltgsrfewwldmnnpecrdaveainklnqvfvdtvrstggnnvsrylmvp
    gyaaapeyvlidefkipkdsskyknriiisvhayrpynfalqapnesgsvsewsvnsees
    rrdidyfmdklydkfvskgipvvigefgardkngnlqsrvefaayyvraarargitccww
    dnnafygngenfglldrktlkwvypeivsammkyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0vH (H:)
    akipeikiasrkipnnaalkfvkdmkigwnlgntfdaafenpsfddellyetawcgvktt
    kqmidtvkkagfntiripvswhnhvtgsnftiskrwldrvqqvvdyamknkmyviinihh
    dimpgyyypnsqhlqtsikyvksiwtqvatrfknyndhlifeavneprltgsrfewwldm
    nnpecrdaveainklnqvfvdtvrstggnnvsrylmvpgyaaapeyvlidefkipkdssk
    yknriiisvhayrpynfalqapnesgsvsewsvnseesrrdidyfmdklydkfvskgipv
    vigefgardkngnlqsrvefaayyvraarargitccwwdnnafygngenfglldrktlkw
    vypeivsammkya