PDB entry 4x00

View 4x00 on RCSB PDB site
Description: X-ray crystal structure of a putative aryl esterase from Burkholderia cenocepacia
Class: hydrolase
Keywords: Hydrolase, aryl esterase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2014-11-20, released 2014-12-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.138
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative hydrolase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAL2527
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x00a_
  • Chain 'B':
    Compound: Putative hydrolase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAL2527
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x00b_
  • Chain 'C':
    Compound: Putative hydrolase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAL2527
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x00c_
  • Chain 'D':
    Compound: Putative hydrolase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAL2527
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x00d_
  • Heterogens: EDO, GOL, F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x00A (A:)
    mahhhhhhaaardytvtapdgvvlavqeagdpegspiifihgllgsrlnwskqlqdprlq
    hyrlitydlrghglsgkpaeassytdgrrwaddlaaiiestharkpvlvgwslggavisn
    ylaaygdkgiagavyvdgvielkpdqivahpevyrdmiasdlqthldgeraflrlcfhrq
    pdattfslllanaalaswdmqravrsmtveaakglskaevpllllygaqdalvkakpsia
    rakslnprirselyadsghapfleeperfnrdlsdfvrmalsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x00A (A:)
    ardytvtapdgvvlavqeagdpegspiifihgllgsrlnwskqlqdprlqhyrlitydlr
    ghglsgkpaeassytdgrrwaddlaaiiestharkpvlvgwslggavisnylaaygdkgi
    agavyvdgvielkpdqivahpevyrdmiasdlqthldgeraflrlcfhrqpdattfslll
    anaalaswdmqravrsmtveaakglskaevpllllygaqdalvkakpsiarakslnprir
    selyadsghapfleeperfnrdlsdfvrmalsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x00B (B:)
    mahhhhhhaaardytvtapdgvvlavqeagdpegspiifihgllgsrlnwskqlqdprlq
    hyrlitydlrghglsgkpaeassytdgrrwaddlaaiiestharkpvlvgwslggavisn
    ylaaygdkgiagavyvdgvielkpdqivahpevyrdmiasdlqthldgeraflrlcfhrq
    pdattfslllanaalaswdmqravrsmtveaakglskaevpllllygaqdalvkakpsia
    rakslnprirselyadsghapfleeperfnrdlsdfvrmalsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x00B (B:)
    rdytvtapdgvvlavqeagdpegspiifihgllgsrlnwskqlqdprlqhyrlitydlrg
    hglsgkpaeassytdgrrwaddlaaiiestharkpvlvgwslggavisnylaaygdkgia
    gavyvdgvielkpdqivahpevyrdmiasdlqthldgeraflrlcfhrqpdattfsllla
    naalaswdmqravrsmtveaakglskaevpllllygaqdalvkakpsiarakslnprirs
    elyadsghapfleeperfnrdlsdfvrmalsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x00C (C:)
    mahhhhhhaaardytvtapdgvvlavqeagdpegspiifihgllgsrlnwskqlqdprlq
    hyrlitydlrghglsgkpaeassytdgrrwaddlaaiiestharkpvlvgwslggavisn
    ylaaygdkgiagavyvdgvielkpdqivahpevyrdmiasdlqthldgeraflrlcfhrq
    pdattfslllanaalaswdmqravrsmtveaakglskaevpllllygaqdalvkakpsia
    rakslnprirselyadsghapfleeperfnrdlsdfvrmalsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x00C (C:)
    ardytvtapdgvvlavqeagdpegspiifihgllgsrlnwskqlqdprlqhyrlitydlr
    ghglsgkpaeassytdgrrwaddlaaiiestharkpvlvgwslggavisnylaaygdkgi
    agavyvdgvielkpdqivahpevyrdmiasdlqthldgeraflrlcfhrqpdattfslll
    anaalaswdmqravrsmtveaakglskaevpllllygaqdalvkakpsiarakslnprir
    selyadsghapfleeperfnrdlsdfvrmalsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x00D (D:)
    mahhhhhhaaardytvtapdgvvlavqeagdpegspiifihgllgsrlnwskqlqdprlq
    hyrlitydlrghglsgkpaeassytdgrrwaddlaaiiestharkpvlvgwslggavisn
    ylaaygdkgiagavyvdgvielkpdqivahpevyrdmiasdlqthldgeraflrlcfhrq
    pdattfslllanaalaswdmqravrsmtveaakglskaevpllllygaqdalvkakpsia
    rakslnprirselyadsghapfleeperfnrdlsdfvrmalsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x00D (D:)
    rdytvtapdgvvlavqeagdpegspiifihgllgsrlnwskqlqdprlqhyrlitydlrg
    hglsgkpaeassytdgrrwaddlaaiiestharkpvlvgwslggavisnylaaygdkgia
    gavyvdgvielkpdqivahpevyrdmiasdlqthldgeraflrlcfhrqpdattfsllla
    naalaswdmqravrsmtveaakglskaevpllllygaqdalvkakpsiarakslnprirs
    elyadsghapfleeperfnrdlsdfvrmalsr