PDB entry 4wvw

View 4wvw on RCSB PDB site
Description: Chicken Galectin-8 N-terminal domain complexed with 3'-sialyl-lactose
Class: sugar binding protein
Keywords: Lectin, carbohydrate recognition domain, sugar binding protein
Deposited on 2014-11-07, released 2015-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4wvwa_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wvwA (A:)
    kkisnpiipyvgtilgglvpgelivlhgsipddadrfqvdlqcgssikpradvafhfnpr
    fkwsgcvvcntlerekwgweeityempfqkgrpfeivimilkdkfqvsvnkkhlllynhr
    isleridtlgiygkvqiksiefvs