PDB entry 4wum

View 4wum on RCSB PDB site
Description: X-ray crystal structure of Chalcone Synthase from Freesia hybrida
Class: transferase
Keywords: Chalon Synthase 2, Polyketide synthase, transferase
Deposited on 2014-11-02, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chalcone synthase
    Species: Freesia hybrid cultivar [TaxId:867926]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wuma1, d4wuma2
  • Chain 'B':
    Compound: chalcone synthase
    Species: Freesia hybrid cultivar [TaxId:867926]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wumb1, d4wumb2
  • Chain 'C':
    Compound: chalcone synthase
    Species: Freesia hybrid cultivar [TaxId:867926]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wumc1, d4wumc2
  • Chain 'D':
    Compound: chalcone synthase
    Species: Freesia hybrid cultivar [TaxId:867926]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wumd1, d4wumd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wumA (A:)
    mvnveeirkaqraegpaailaigtatppnaieqseypdyyfrvtnsedkvelkekfkrmc
    eksmikkrylyltedilkenpnvcaymatsldarqdmvvvevpklgkeaatraikewgqp
    kskithlvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlrlakdlaen
    nrgarvlvvcseitavtfrgpseshldslvgqalfgdgaaalivgsdaiegierpifemv
    saaqtilpdsegaidghlrevgltfhllkdvpgiisknieksleeafkplgitdynslfw
    iahpggpaildqveakiglkpeklratrhvlseygnmssacvlfileemrkksaeekngt
    tgeglewgvlfgfgpgltvetvvlhsvea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wumB (B:)
    mvnveeirkaqraegpaailaigtatppnaieqseypdyyfrvtnsedkvelkekfkrmc
    eksmikkrylyltedilkenpnvcaymatsldarqdmvvvevpklgkeaatraikewgqp
    kskithlvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlrlakdlaen
    nrgarvlvvcseitavtfrgpseshldslvgqalfgdgaaalivgsdaiegierpifemv
    saaqtilpdsegaidghlrevgltfhllkdvpgiisknieksleeafkplgitdynslfw
    iahpggpaildqveakiglkpeklratrhvlseygnmssacvlfileemrkksaeekngt
    tgeglewgvlfgfgpgltvetvvlhsvea
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wumC (C:)
    mvnveeirkaqraegpaailaigtatppnaieqseypdyyfrvtnsedkvelkekfkrmc
    eksmikkrylyltedilkenpnvcaymatsldarqdmvvvevpklgkeaatraikewgqp
    kskithlvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlrlakdlaen
    nrgarvlvvcseitavtfrgpseshldslvgqalfgdgaaalivgsdaiegierpifemv
    saaqtilpdsegaidghlrevgltfhllkdvpgiisknieksleeafkplgitdynslfw
    iahpggpaildqveakiglkpeklratrhvlseygnmssacvlfileemrkksaeekngt
    tgeglewgvlfgfgpgltvetvvlhsvea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wumD (D:)
    mvnveeirkaqraegpaailaigtatppnaieqseypdyyfrvtnsedkvelkekfkrmc
    eksmikkrylyltedilkenpnvcaymatsldarqdmvvvevpklgkeaatraikewgqp
    kskithlvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlrlakdlaen
    nrgarvlvvcseitavtfrgpseshldslvgqalfgdgaaalivgsdaiegierpifemv
    saaqtilpdsegaidghlrevgltfhllkdvpgiisknieksleeafkplgitdynslfw
    iahpggpaildqveakiglkpeklratrhvlseygnmssacvlfileemrkksaeekngt
    tgeglewgvlfgfgpgltvetvvlhsvea