PDB entry 4wqp

View 4wqp on RCSB PDB site
Description: Crystal structure of RORc in complex with a benzyl sulfonamide inverse agonist
Class: transcription
Keywords: nuclear receptor ligand binding domain, transcription
Deposited on 2014-10-22, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wqpa_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wqpb_
  • Chain 'P':
    Compound: val-glu-arg-leu-gln-ile-phe-gln-his-leu-his-pro-ile
    Species: Homo sapiens [TaxId:9606]
    Gene: Nuclear receptor ROR-gamma
    Database cross-references and differences (RAF-indexed):
    • PDB 4WQP (0-12)
  • Heterogens: 3SX, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wqpA (A:)
    mhhhhhhgenlyfqgsapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreev
    tgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrm
    craynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytalvl
    inahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqi
    fqhlhpivvqaafpplykelfsgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wqpA (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wqpB (B:)
    mhhhhhhgenlyfqgsapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreev
    tgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrm
    craynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytalvl
    inahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqi
    fqhlhpivvqaafpplykelfsgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wqpB (B:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppkgklrslcsqhverlqif
    

  • Chain 'P':
    No sequence available.