PDB entry 4wq2

View 4wq2 on RCSB PDB site
Description: Human calpain PEF(S) with (Z)-3-(6-bromondol-3-yl)-2-mercaptoacrylic acid bound
Class: hydrolase
Keywords: Calpain, Domain VI, PEF(S), Human, Calcium Binding, Protease, EF-Hand, hydrolase
Deposited on 2014-10-21, released 2015-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-02, with a file datestamp of 2015-08-28.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calpain small subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPNS1, CAPN4, CAPNS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wq2a_
  • Chain 'B':
    Compound: Calpain small subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPNS1, CAPN4, CAPNS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wq2b_
  • Heterogens: 3SU, CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wq2A (A:)
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynmiir
rysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wq2B (B:)
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynmiir
rysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys