PDB entry 4woh

View 4woh on RCSB PDB site
Description: Structure of of human dual-specificity phosphatase 22 (E24A/K28A/K30A/C88S) complexed with 4-nitrophenolphosphate
Class: hydrolase
Keywords: dual specificity phosphatase, JSP-1, pNPP, HYDROLASE
Deposited on 2014-10-15, released 2015-02-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity protein phosphatase 22
    Species: Homo sapiens [TaxId:9606]
    Gene: DUSP22, JSP1, LMWDSP2, MKPX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRW4 (3-End)
      • expression tag (0-2)
      • engineered mutation (26)
      • engineered mutation (30)
      • engineered mutation (32)
      • engineered mutation (90)
    Domains in SCOPe 2.08: d4woha1, d4woha2
  • Heterogens: 4NP, PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4wohA (A:)
ggpmgngmnkilpglyignfkdardaaqlsanavthilsvhdsarpmlegvkylcipaad
spsqnltrhfkesikfihecrlrgesclvhslagvsrsvtlviayimtvtdfgwedalht
vragrscanpnvgfqrqlqefekhevhqyrqwlkeeygesplqdae

    Sequence, based on observed residues (ATOM records): (download) 
    >4wohA (A:)
ggpmgngmnkilpglyignfkdardaaqlsanavthilsvhdsarpmlegvkylcipaad
spsqnltrhfkesikfihecrlrgesclvhslagvsrsvtlviayimtvtdfgwedalht
vragrscanpnvgfqrqlqefekhevhqyrqwlkeeyg