PDB entry 4wmh

View 4wmh on RCSB PDB site
Description: Structure of heme oxygenase-2 containing residues 1-288 lacking the membrane spanning region
Class: oxidoreductase
Keywords: HO2, Heme oxygenase, Oxygenase, Structural Genomics, PSI-2, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, OXIDOREDUCTASE
Deposited on 2014-10-09, released 2014-11-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX2, HO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4wmha_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wmhA (A:)
adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd
hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv
ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald
lnmktkeriveeankafeynmqifnel