PDB entry 4wln

View 4wln on RCSB PDB site
Description: Crystal structure of apo MDH2
Class: oxidoreductase
Keywords: MDH2, TCA cycle, OXIDOREDUCTASE
Deposited on 2014-10-07, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wlna1, d4wlna2
  • Chain 'B':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wlnb1, d4wlnb2
  • Chain 'C':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wlnc1, d4wlnc2
  • Chain 'D':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wlnd1, d4wlnd2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wlnA (A:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wlnA (A:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wlnB (B:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wlnB (B:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wlnC (C:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wlnC (C:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wlnD (D:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wlnD (D:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl