PDB entry 4wlf

View 4wlf on RCSB PDB site
Description: Crystal structure of L-malate bound MDH2
Class: oxidoreductase
Keywords: MDH2, TCA cycle, OXIDOREDUCTASE
Deposited on 2014-10-07, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wlfa1, d4wlfa2
  • Chain 'B':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wlfb1, d4wlfb2
  • Chain 'C':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wlfc1, d4wlfc2
  • Chain 'D':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wlfd1, d4wlfd2
  • Heterogens: LMR, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wlfA (A:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wlfA (A:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wlfB (B:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wlfB (B:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wlfC (C:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wlfC (C:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wlfD (D:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wlfD (D:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl