PDB entry 4wle

View 4wle on RCSB PDB site
Description: Crystal structure of citrate bound MDH2
Class: oxidoreductase
Keywords: MDH2, TCA cycle, OXIDOREDUCTASE
Deposited on 2014-10-07, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wlea1, d4wlea2
  • Chain 'B':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wleb1, d4wleb2
  • Chain 'C':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wlec1, d4wlec2
  • Chain 'D':
    Compound: Malate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wled1, d4wled2
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wleA (A:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wleA (A:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wleB (B:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wleB (B:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wleC (C:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wleC (C:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wleD (D:)
    mgsshhhhhhssglvprgshmsaqnnakvavlgasggigqplslllknsplvsrltlydi
    ahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfntna
    tivatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivran
    tfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagtevv
    kakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgkkg
    ieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wleD (D:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl