PDB entry 4wke

View 4wke on RCSB PDB site
Description: Crystal structure of human ADAMTS-4 in complex with inhibitor 5-chloro-N-{[(4R)-2,5-dioxo-4-(1,3-thiazol-2-yl)imidazolidin-4-yl]methyl}-1-benzofuran-2-carboxamide (compound 10)
Class: hydrolase/hydrolase inhibitor
Keywords: Metalloprotease, Osteoarthritis, Inhibitor
Deposited on 2014-10-02, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A disintegrin and metalloproteinase with thrombospondin motifs 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAMTS4, KIAA0688, UNQ769/PRO1563
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wkea_
  • Heterogens: ZN, CA, EDO, 3PU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wkeA (A:)
    faslsrfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvil
    gsgeegpqvgpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgm
    advgtvcdparscaiveddglqsaftaahelghvfnmlhdnskpcislngplstsrhvma
    pvmahvdpeepwspcsarfitdfldngyghclldkpeaplhlpvtfpdvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wkeA (A:)
    lsrfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilegp
    qvgpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgmadvgtvc
    dparscaiveddglqsaftaahelghvfnmlhdnskpcislngplsrhvmapvmahvdpe
    epwspcsarfitdfldngyghclldkpeaplhlp