PDB entry 4wk7

View 4wk7 on RCSB PDB site
Description: Crystal structure of human ADAMTS-4 in complex with inhibitor (compound 1, 2-(4-chlorophenoxy)-N-{[(4R)-4-methyl-2,5-dioxoimidazolidin-4-yl]methyl} acetamide)
Class: hydrolase/hydrolase inhibitor
Keywords: Metalloprotease, Osteoarthritis, Inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 2014-10-01, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A disintegrin and metalloproteinase with thrombospondin motifs 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAMTS4, KIAA0688, UNQ769/PRO1563
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wk7a_
  • Heterogens: ZN, CA, 3PQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wk7A (A:)
    faslsrfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvil
    gsgeegpqvgpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgm
    advgtvcdparscaiveddglqsaftaahelghvfnmlhdnskpcislngplstsrhvma
    pvmahvdpeepwspcsarfitdfldngyghclldkpeaplhlpvtfpdvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wk7A (A:)
    srfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilgpqv
    gpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgmadvgtvcdp
    arscaiveddglqsaftaahelghvfnmlhdnskpcislngplsrhvmapvmahvdpeep
    wspcsarfitdfldngyghclldkpeapl