PDB entry 4wk5

View 4wk5 on RCSB PDB site
Description: Crystal structure of a Isoprenoid Synthase family member from Thermotoga neapolitana DSM 4359, target EFI-509458
Class: transferase
Keywords: Isoprenoid Synthase, enzyme function initiative, EFI, Structural Genomics, TRANSFERASE
Deposited on 2014-10-01, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: THERMOTOGA NEAPOLITANA [TaxId:309803]
    Gene: CTN_0526
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9K6W9 (22-End)
      • expression tag (21)
    Domains in SCOPe 2.07: d4wk5a1, d4wk5a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wk5A (A:)
    mhhhhhhssgvdlgtenlyfqsmkketierrieelvkphfnlltesamqysvtaggkrir
    pllvltvgedigveeerlvdvavavelfhtaslvhddlppidnadfrrgkpschraygeg
    iallagdglfflafsqiakvrepklfeefsetayklllgeamdveferqekeisvemvek
    mysfktgalfafcfsapfllkgldhtfvkklgekfgvafqiyddlkdvlgsleklgkdvg
    kdvkkvtlvkkmgvqkakqladkyyeevlealeseglhrtfdflrnlkkmveer
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wk5A (A:)
    smkketierrieelvkphfnlltesamqysvtaggkrirpllvltvgedigveeerlvdv
    avavelfhtaslvhddlppidnadfrrgkpschraygegiallagdglfflafsqiakvr
    epklfeefsetayklllgeamdveferqekeisvemvekmysfktgalfafcfsapfllk
    gldhtfvkklgekfgvafqiyddlkdvlgskvtlvkkmgvqkakqladkyyeevleales
    eglhrtfdflrnlkkm