PDB entry 4wjo

View 4wjo on RCSB PDB site
Description: Crystal Structure of SUMO1 in complex with PML
Class: protein binding/signaling protein
Keywords: SUMO1, PML, SUMO Interaction Motif, PhosphoSIM
Deposited on 2014-10-01, released 2014-12-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.158
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Small ubiquitin-related modifier 1
  Species: Homo sapiens [TaxId:9606]
  Gene: SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63165
    • engineered mutation (37)
  Domains in SCOPe 2.05: d4wjoa_
• Chain 'B':
  Compound: Protein PML
  Species: Homo sapiens [TaxId:9606]
  Gene: PML, MYL, PP8675, RNF71, TRIM19
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29590 (Start-27)
    • expression tag (28)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4wjoA (A:)
  gskegeyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadn
  htpkelgmeeedvievyqeqtgg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4wjoA (A:)
  egeyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnhtp
  kelgmeeedvievyqeq
  

  
  
• Chain 'B':
  No sequence available.