PDB entry 4wi5

View 4wi5 on RCSB PDB site
Description: Structural mapping of the human IgG1 binding site for FcRn: hu3S193 Fc mutation H310A
Class: immune system
Keywords: Human IgG1, FcRn binding site, Therapeutic antibody, IMMUNE SYSTEM
Deposited on 2014-09-25, released 2015-09-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-207)
      • engineered mutation (73)
    Domains in SCOPe 2.05: d4wi5a1, d4wi5a2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-207)
      • engineered mutation (73)
    Domains in SCOPe 2.05: d4wi5b1, d4wi5b2
  • Heterogens: NAG, BMA, MAN, FUC, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wi5A (A:)
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlaqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
wqqgnvfscsvmhealhnhytqkslsls

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wi5B (B:)
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlaqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
wqqgnvfscsvmhealhnhytqkslsls