PDB entry 4whx

View 4whx on RCSB PDB site
Description: X-ray Crystal Structure of an Amino Acid Aminotransferase from Burkholderia pseudomallei Bound to the Co-factor Pyridoxal Phosphate
Class: transferase
Keywords: SSGCID, Burkholderia pseudomallei, pyridoxal phosphate, aminotransferase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2014-09-23, released 2014-10-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.164
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Branched-chain-amino-acid transaminase
    Species: Burkholderia pseudomallei 576 [TaxId:557724]
    Gene: ilvE, BUC_1039
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4whxa_
  • Chain 'B':
    Compound: Branched-chain-amino-acid transaminase
    Species: Burkholderia pseudomallei 576 [TaxId:557724]
    Gene: ilvE, BUC_1039
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4whxb_
  • Chain 'C':
    Compound: Branched-chain-amino-acid transaminase
    Species: Burkholderia pseudomallei 576 [TaxId:557724]
    Gene: ilvE, BUC_1039
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4whxc_
  • Chain 'D':
    Compound: Branched-chain-amino-acid transaminase
    Species: Burkholderia pseudomallei 576 [TaxId:557724]
    Gene: ilvE, BUC_1039
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4whxd_
  • Chain 'E':
    Compound: Branched-chain-amino-acid transaminase
    Species: Burkholderia pseudomallei 576 [TaxId:557724]
    Gene: ilvE, BUC_1039
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4whxe_
  • Chain 'F':
    Compound: Branched-chain-amino-acid transaminase
    Species: Burkholderia pseudomallei 576 [TaxId:557724]
    Gene: ilvE, BUC_1039
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4whxf_
  • Heterogens: ALA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4whxA (A:)
    gpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrl
    kehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakg
    ntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqea
    tadgydeallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagie
    viekritrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngk
    sakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whxA (A:)
    smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
    rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
    aiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgy
    deallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekr
    itrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakha
    dwltki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4whxB (B:)
    gpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrl
    kehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakg
    ntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqea
    tadgydeallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagie
    viekritrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngk
    sakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whxB (B:)
    smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
    rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
    aiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgy
    deallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekr
    itrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakha
    dwltki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4whxC (C:)
    gpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrl
    kehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakg
    ntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqea
    tadgydeallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagie
    viekritrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngk
    sakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whxC (C:)
    smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
    rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
    aiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgy
    deallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekr
    itrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakha
    dwltki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4whxD (D:)
    gpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrl
    kehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakg
    ntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqea
    tadgydeallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagie
    viekritrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngk
    sakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whxD (D:)
    smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
    rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
    aiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgy
    deallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekr
    itrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakha
    dwltki
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4whxE (E:)
    gpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrl
    kehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakg
    ntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqea
    tadgydeallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagie
    viekritrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngk
    sakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whxE (E:)
    smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
    rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
    aiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgy
    deallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekr
    itrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakha
    dwltki
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4whxF (F:)
    gpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrl
    kehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakg
    ntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqea
    tadgydeallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagie
    viekritrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngk
    sakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whxF (F:)
    smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
    rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
    aiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgy
    deallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekr
    itrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakha
    dwltki