PDB entry 4wht

View 4wht on RCSB PDB site
Description: Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423 bound to the broadly neutralizing antibody 3/11, P1 crystal form
Class: viral protein
Keywords: neutralizing epitope, envelope glycoprotein, E2, receptor-binding, viral protein
Deposited on 2014-09-23, released 2014-12-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.211
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
  • Chain 'B':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whtb1, d4whtb2
  • Chain 'C':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
  • Chain 'D':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whtd1, d4whtd2
  • Chain 'E':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
  • Chain 'F':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whtf1
  • Chain 'G':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT (0-End)
  • Chain 'H':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whth1
  • Chain 'I':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
  • Chain 'J':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whtj1
  • Chain 'K':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
  • Chain 'L':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whtl1, d4whtl2
  • Chain 'M':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
  • Chain 'N':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whtn1, d4whtn2
  • Chain 'O':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
  • Chain 'P':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whtp1, d4whtp2
  • Chain 'Q':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
  • Chain 'R':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whtr1, d4whtr2
  • Chain 'S':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
  • Chain 'T':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whtt1, d4whtt2
  • Chain 'U':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
  • Chain 'V':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whtv1, d4whtv2
  • Chain 'X':
    Compound: Heavy chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
  • Chain 'Y':
    Compound: Light chain of the Fab fragment derived from neutralizing antibody 3/11
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WHT
    Domains in SCOPe 2.06: d4whty1, d4whty2
  • Chain 'a':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: epitope peptide
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4whtB (B:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtB (B:)
    divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
    sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptvs
    ifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysms
    stlsltkadyeshnlytcevvhktssspvvksfnr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4whtD (D:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtD (D:)
    divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
    sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptvs
    ifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysms
    stlsltkadyeshnlytcevvhktssspvvksfnrn
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4whtF (F:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtF (F:)
    divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
    sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptvs
    ifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysms
    stlsltkadyeshnlytcevvhktssspvvksfnr
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4whtH (H:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtH (H:)
    sdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnl
    esgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptv
    sifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysm
    sstlsltkadyeshnlytcevvhktssspvvksfnr
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4whtJ (J:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtJ (J:)
    divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
    sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptvs
    ifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysms
    stlsltkadyeshnlytcevvhktssspvvksfnr
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4whtL (L:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtL (L:)
    divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
    sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptvs
    ifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysms
    stlsltkadyeshnlytcevvhktssspvvksfnr
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4whtN (N:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtN (N:)
    divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
    sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptvs
    ifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysms
    stlsltkadyeshnlytcevvhktssspvvksfnr
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4whtP (P:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtP (P:)
    divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
    sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptvs
    ifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysms
    stlsltkadyeshnlytcevvhktssspvvksfnr
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4whtR (R:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtR (R:)
    divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
    sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptvs
    ifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysms
    stlsltkadyeshnlytcevvhktssspvvksfnr
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4whtT (T:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtT (T:)
    divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
    sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptvs
    ifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysms
    stlsltkadyeshnlytcevvhktssspvvksfnr
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4whtV (V:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtV (V:)
    divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
    sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptvs
    ifppsteqlatggasvvclmnnfyprdisvkwkierrdgvldsvtdqdskdstysmsstl
    sltkadyeshnlytcevvhktssspvvksfnr
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4whtY (Y:)
    rsdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsn
    lesgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaapt
    vsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstys
    msstlsltkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whtY (Y:)
    divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
    sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelkradaaptvs
    ifppstelatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmss
    tlslteshnlytcevvhktssspvvksfnr
    

  • Chain 'a':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'q':
    No sequence available.

  • Chain 's':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'x':
    No sequence available.