PDB entry 4wh4

View 4wh4 on RCSB PDB site
Description: Protein GB1 Quadruple Mutant I6H/N8H/K28H/Q32H
Class: signaling protein
Keywords: Immunoglobulin-Binding Domain, SIGNALING PROTEIN
Deposited on 2014-09-19, released 2015-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • expression tag (0-1)
      • engineered mutation (5)
      • engineered mutation (7)
      • engineered mutation (27)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d4wh4a1, d4wh4a2
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • expression tag (0-1)
      • engineered mutation (5)
      • engineered mutation (7)
      • engineered mutation (27)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d4wh4b1, d4wh4b2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wh4A (A:)
    mqyklhlhgktlkgettteavdaataehvfkhyandngvdgewtyddatktftvte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wh4B (B:)
    mqyklhlhgktlkgettteavdaataehvfkhyandngvdgewtyddatktftvte