PDB entry 4wfg

View 4wfg on RCSB PDB site
Description: Human TRAAK K+ channel in a Tl+ bound conductive conformation
Class: metal transport
Keywords: Mechanosensitive ion channel, two-pore domain potassium ion channel, membrane protein
Deposited on 2014-09-15, released 2014-12-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.204
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel subfamily K member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: KCNK4, TRAAK
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Potassium channel subfamily K member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: KCNK4, TRAAK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NYG8
      • engineered mutation (103)
  • Chain 'D':
    Compound: anti-traak antibody 13e9 fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WFG (0-210)
    Domains in SCOPe 2.06: d4wfgd1, d4wfgd2
  • Chain 'E':
    Compound: anti-traak antibody 13e9 fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WFG (0-216)
  • Chain 'F':
    Compound: anti-traak antibody 13e9 fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WFG (0-210)
    Domains in SCOPe 2.06: d4wfgf1, d4wfgf2
  • Chain 'G':
    Compound: anti-traak antibody 13e9 fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WFG (0-End)
  • Heterogens: TL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wfgD (D:)
    qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwsnspptfgagaklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wfgF (F:)
    qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwsnspptfgagaklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'G':
    No sequence available.