PDB entry 4wf2

View 4wf2 on RCSB PDB site
Description: Structure of E. coli BirA G142A bound to biotinol-5'-AMP
Class: ligase
Keywords: biotin protein ligase, biotin repressor, G142A mutant, complex with biotinol-5'-AMP
Deposited on 2014-09-11, released 2014-10-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional ligase/repressor BirA
    Species: Escherichia coli [TaxId:83333]
    Gene: birA, bioR, dhbB, b3973, JW3941
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06709
      • engineered mutation (141)
    Domains in SCOPe 2.06: d4wf2a1, d4wf2a2, d4wf2a3
  • Heterogens: BTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wf2A (A:)
    mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
    pepiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrg
    rkwfspfganlylsmfwrleqapaaaiglslvigivmaevlrklgadkvrvkwpndlylq
    drklagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaa
    mlirelraalelfeqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgalll
    eqdgiikpwmggeislrsaekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wf2A (A:)
    dntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslpe
    piqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrk
    wfspfganlylsmfwrleqapaaaiglslvigivmaevlrklgadkvrvkwpndlylqdr
    klagilveltdaaqivigaginmamgwitlqeaginldrntlaamlirelraalelfeqe
    glapylsrwekldnfinrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeisl
    rsae