PDB entry 4weu

View 4weu on RCSB PDB site
Description: Co-complex structure of the F4 fimbrial adhesin FaeG variant ad with llama single domain antibody V3
Class: cell adhesion
Keywords: Complex, Adhesin, Nanobody, Llama single domain antibody, cell adhesion
Deposited on 2014-09-11, released 2015-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: K88 fimbrial protein AD
    Species: Escherichia coli [TaxId:562]
    Gene: faeG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14191
      • expression tag (262-276)
  • Chain 'B':
    Compound: K88 fimbrial protein AD
    Species: Escherichia coli [TaxId:562]
    Gene: faeG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14191
      • expression tag (263-276)
  • Chain 'D':
    Compound: Anti-F4+ETEC bacteria VHH variable region
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4weud_
  • Chain 'E':
    Compound: Anti-F4+ETEC bacteria VHH variable region
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4weue_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4weuD (D:)
    qvqlqesggglvqaggslrlscaasgltfdtyamgwfrqapgkkreyvaaiswtgistyy
    adiakgrftisrdnakntlylqmdslkpedtavyycaaqkslnvpapwdywgqgtqvtvs
    shhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4weuD (D:)
    qvqlqesggglvqaggslrlscaasgltfdtyamgwfrqapgkkreyvaaiswtgistyy
    adiakgrftisrdnakntlylqmdslkpedtavyycaaqkslnvpapwdywgqgtqvtvs
    s
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4weuE (E:)
    qvqlqesggglvqaggslrlscaasgltfdtyamgwfrqapgkkreyvaaiswtgistyy
    adiakgrftisrdnakntlylqmdslkpedtavyycaaqkslnvpapwdywgqgtqvtvs
    shhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4weuE (E:)
    qvqlqesggglvqaggslrlscaasgltfdtyamgwfrqapgkkreyvaaiswtgistyy
    adiakgrftisrdnakntlylqmdslkpedtavyycaaqkslnvpapwdywgqgtqvtvs
    s