PDB entry 4wco

View 4wco on RCSB PDB site
Description: Crystal structure of extracellular domain of human lectin-like transcript 1 (LLT1), the ligand for natural killer receptor-P1A
Class: immune system
Keywords: receptor, ectodomain, immunology, lectin
Deposited on 2014-09-05, released 2015-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 2 member D
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC2D, CLAX, LLT1, OCIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHP7 (1-End)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d4wcoa_
  • Chain 'B':
    Compound: C-type lectin domain family 2 member D
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC2D, CLAX, LLT1, OCIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHP7 (1-End)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d4wcob_
  • Chain 'C':
    Compound: C-type lectin domain family 2 member D
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC2D, CLAX, LLT1, OCIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHP7
      • engineered mutation (106)
    Domains in SCOPe 2.07: d4wcoc_
  • Heterogens: ZN, ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wcoA (A:)
    mlqaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgps
    dhwiglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksdi
    hv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wcoA (A:)
    lqaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsd
    hwiglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wcoB (B:)
    mlqaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgps
    dhwiglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksdi
    hv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wcoB (B:)
    lqaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsd
    hwiglsreqpwkwinwtrqfpilgagecaylndkgassarcyterkwicsksd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wcoC (C:)
    mlqaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgps
    dhwiglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksdi
    hv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wcoC (C:)
    acpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsdhwi
    glsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsks