PDB entry 4wbk

View 4wbk on RCSB PDB site
Description: The 1.37 angstrom X-ray structure of the human heart fatty acid-binding protein complexed with stearic acid
Class: lipid binding protein
Keywords: lipid-binding protein, lipid binding protein
Deposited on 2014-09-03, released 2015-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.154
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wbka_
  • Heterogens: STE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wbkA (A:)
    mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
    teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
    gtavctrtyekea