PDB entry 4wba

View 4wba on RCSB PDB site
Description: Q/E mutant SA11 NSP4_CCD
Class: viral protein
Keywords: Nonstructural protein, Enterotoxin, CCD, Ca2+-binding mutant, VIRAL PROTEIN
Deposited on 2014-09-02, released 2014-09-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-structural glycoprotein nsp4
    Species: Simian rotavirus A/SA11 [TaxId:10923]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O92323 (0-End)
      • engineered mutation (25)
      • engineered mutation (28)
    Domains in SCOPe 2.06: d4wbaa_
  • Chain 'B':
    Compound: non-structural glycoprotein nsp4
    Species: Simian rotavirus A/SA11 [TaxId:10923]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O92323 (0-End)
      • engineered mutation (25)
      • engineered mutation (28)
    Domains in SCOPe 2.06: d4wbab_
  • Chain 'C':
    Compound: non-structural glycoprotein nsp4
    Species: Simian rotavirus A/SA11 [TaxId:10923]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O92323 (0-End)
      • engineered mutation (25)
      • engineered mutation (28)
    Domains in SCOPe 2.06: d4wbac_
  • Chain 'D':
    Compound: non-structural glycoprotein nsp4
    Species: Simian rotavirus A/SA11 [TaxId:10923]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O92323 (0-End)
      • engineered mutation (25)
      • engineered mutation (28)
    Domains in SCOPe 2.06: d4wbad_
  • Chain 'E':
    Compound: non-structural glycoprotein nsp4
    Species: Simian rotavirus A/SA11 [TaxId:10923]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O92323 (0-End)
      • engineered mutation (25)
      • engineered mutation (28)
    Domains in SCOPe 2.06: d4wbae_
  • Heterogens: GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wbaA (A:)
    iekqmdrvvkemrrqlemidklttraieavellkriydkltvqttgeidmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wbaA (A:)
    iekqmdrvvkemrrqlemidklttraieavellkriydkltv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wbaB (B:)
    iekqmdrvvkemrrqlemidklttraieavellkriydkltvqttgeidmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wbaB (B:)
    iekqmdrvvkemrrqlemidklttraieavellkriydklt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wbaC (C:)
    iekqmdrvvkemrrqlemidklttraieavellkriydkltvqttgeidmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wbaC (C:)
    iekqmdrvvkemrrqlemidklttraieavellkriydklt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wbaD (D:)
    iekqmdrvvkemrrqlemidklttraieavellkriydkltvqttgeidmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wbaD (D:)
    iekqmdrvvkemrrqlemidklttraieavellkriydklt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4wbaE (E:)
    iekqmdrvvkemrrqlemidklttraieavellkriydkltvqttgeidmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wbaE (E:)
    iekqmdrvvkemrrqlemidklttraieavellkriydkltv