PDB entry 4wb4

View 4wb4 on RCSB PDB site
Description: wt SA11 NSP4_CCD
Class: viral protein
Keywords: Nonstructural protein, enterotoxin, Ca2+-binding protein, VIRAL PROTEIN
Deposited on 2014-09-02, released 2014-09-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.236
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-structural glycoprotein nsp4
    Species: Simian rotavirus A/SA11 [TaxId:10923]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wb4a_
  • Chain 'B':
    Compound: non-structural glycoprotein nsp4
    Species: Simian rotavirus A/SA11 [TaxId:10923]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wb4b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wb4A (A:)
    iekqmdrvvkemrrqlemidklttreieqvellkriydkltvqttgeidmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wb4A (A:)
    ekqmdrvvkemrrqlemidklttreieqvellkriydkltv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wb4B (B:)
    iekqmdrvvkemrrqlemidklttreieqvellkriydkltvqttgeidmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wb4B (B:)
    iekqmdrvvkemrrqlemidklttreieqvellkriydklt