PDB entry 4wa7

View 4wa7 on RCSB PDB site
Description: Crystal Structure of a GDP-bound Q61L Oncogenic Mutant of Human GT- Pase KRas
Class: signaling protein, hydrolase
Keywords: SMALL GTPASE, SIGNAL TRANSDUCTION, GDP BINDING, GTP BINDING, Hydrolase, signaling protein
Deposited on 2014-08-28, released 2015-06-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.05: d4wa7a_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wa7A (A:)
    gmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gleeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wa7A (A:)
    gmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    ymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqa
    qdlarsygipfietsaktrqgvddafytlvreirkhk