PDB entry 4w9y

View 4w9y on RCSB PDB site
Description: X-ray structure of human glutamate carboxypeptidase II (GCPII) in complex with a glutamyl sulfamide inhibitor CJC47
Class: hydrolase
Keywords: glutamate carboxypeptidase II (GCPII), NAALADase, prostate-specific membrane antigen, glutamyl sulfamide, hydrolase
Deposited on 2014-08-28, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOLH1, FOLH, NAALAD1, PSM, PSMA, GIG27
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4w9ya1, d4w9ya2, d4w9ya3
  • Heterogens: NAG, BMA, MAN, ZN, CA, CL, 3K0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w9yA (A:)
    kssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkef
    gldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsa
    fspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagak
    gvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgi
    aeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvk
    mhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfg
    tlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlr
    vdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfev
    ffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggm
    vfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteia
    skfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyage
    sfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w9yA (A:)
    khnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahyd
    vllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdl
    vyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpady
    fapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipv
    hpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtr
    iynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprr
    tilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslv
    hnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgr
    arytknnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpfdc
    rdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfsnpi
    vlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdieskv
    dpskawgevkrqiyvaaftvqaaaetlseva