PDB entry 4w9u

View 4w9u on RCSB PDB site
Description: Crystal Structure of an Acyl-CoA dehydrogenase from Brucella melitensis
Class: oxidoreductase
Keywords: SSGCID, NIAID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, oxidoreductase
Deposited on 2014-08-27, released 2014-09-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Brucella abortus 2308 [TaxId:359391]
    Database cross-references and differences (RAF-indexed):
    • PDB 4W9U (Start-394)
    Domains in SCOPe 2.07: d4w9ua1, d4w9ua2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Brucella abortus 2308 [TaxId:359391]
    Database cross-references and differences (RAF-indexed):
    • PDB 4W9U (Start-394)
    Domains in SCOPe 2.07: d4w9ub1, d4w9ub2
  • Chain 'C':
    Compound: acyl-CoA dehydrogenase
    Species: Brucella abortus 2308 [TaxId:359391]
    Database cross-references and differences (RAF-indexed):
    • PDB 4W9U (Start-394)
    Domains in SCOPe 2.07: d4w9uc1, d4w9uc2
  • Chain 'D':
    Compound: acyl-CoA dehydrogenase
    Species: Brucella abortus 2308 [TaxId:359391]
    Database cross-references and differences (RAF-indexed):
    • PDB 4W9U (Start-394)
    Domains in SCOPe 2.07: d4w9ud1, d4w9ud2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w9uA (A:)
    smsraafawedpflleeqltedermirdsakafasdvllprvekayleettdpelfhlmg
    qagllgvtlpedygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeq
    rkkylpglvsgeligcfgltepdagsdpagmktraekidggyrlsgskmwisnspiadvf
    vvwaksaahdnairgfilekgmkglsapkiggklslrasitgeivmdgvevsedailpnv
    sglkgpfgclnrarygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmq
    teialgiqaslrvgrlfdegkmapemisivkrnncgkaldiarqardmhggngiqieyhv
    mrhaqnletvntyegthdvhalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w9uA (A:)
    raafawedpflleeqltedermirdsakafasdvllprvedpelfhlmgqagllgvtlpe
    dygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeqrkkylpglvsg
    eligcfgltepmktraekidggyrlsgskmwisnspiadvfvvwaksaahdnairgfile
    kgmkglsapkiasitgeivmdgvevsedailpnvsglkgpfgclnrarygiswgvlgaae
    dcwfrarqygldrkqfnkplagtqlyqkkladmqteialgiqaslrvgrlfdegkmapem
    isivkrnncgkaldiarqardmhgyhvmrhaqnletvntyegthdvhalilgraqtgiqa
    ff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4w9uB (B:)
    smsraafawedpflleeqltedermirdsakafasdvllprvekayleettdpelfhlmg
    qagllgvtlpedygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeq
    rkkylpglvsgeligcfgltepdagsdpagmktraekidggyrlsgskmwisnspiadvf
    vvwaksaahdnairgfilekgmkglsapkiggklslrasitgeivmdgvevsedailpnv
    sglkgpfgclnrarygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmq
    teialgiqaslrvgrlfdegkmapemisivkrnncgkaldiarqardmhggngiqieyhv
    mrhaqnletvntyegthdvhalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w9uB (B:)
    raafawedpflleeqltedermirdsakafasdvllprvekeettdpelfhlmgqagllg
    vtlpedygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeqrkkylp
    glvsgeligcfgltepdpagmktraekidggyrlsgskmwisnspiadvfvvwaksaahd
    nairgfilekgmkglsapkigglrasitgeivmdgvevsedailpnvsglkgpfgclnra
    rygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmqteialgiqaslrv
    grlfdegkmapemisivkrnncgkaldiarqardmhgeyhvmrhaqnletvntyegthdv
    halilgraqtgiqaff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4w9uC (C:)
    smsraafawedpflleeqltedermirdsakafasdvllprvekayleettdpelfhlmg
    qagllgvtlpedygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeq
    rkkylpglvsgeligcfgltepdagsdpagmktraekidggyrlsgskmwisnspiadvf
    vvwaksaahdnairgfilekgmkglsapkiggklslrasitgeivmdgvevsedailpnv
    sglkgpfgclnrarygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmq
    teialgiqaslrvgrlfdegkmapemisivkrnncgkaldiarqardmhggngiqieyhv
    mrhaqnletvntyegthdvhalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w9uC (C:)
    aafawedpflleeqltedermirdsakafasdvllprvektdpelfhlmgqagllgvtlp
    edygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeqrkkylpglvs
    geligcfgltepmktraekidggyrlsgskmwisnspiadvfvvwaksaahdnairgfil
    ekgmkglsapkilrasitgeivmdgvevsedailpnvsglkgpfgclnrarygiswgvlg
    aaedcwfrarqygldrkqfnkplagtqlyqkkladmqteialgiqaslrvgrlfdegkma
    pemisivkrnncgkaldiarqardmhgghvmrhaqnletvntyegthdvhalilgraqtg
    iqaff
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4w9uD (D:)
    smsraafawedpflleeqltedermirdsakafasdvllprvekayleettdpelfhlmg
    qagllgvtlpedygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeq
    rkkylpglvsgeligcfgltepdagsdpagmktraekidggyrlsgskmwisnspiadvf
    vvwaksaahdnairgfilekgmkglsapkiggklslrasitgeivmdgvevsedailpnv
    sglkgpfgclnrarygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmq
    teialgiqaslrvgrlfdegkmapemisivkrnncgkaldiarqardmhggngiqieyhv
    mrhaqnletvntyegthdvhalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w9uD (D:)
    aafawedpflleeqltedermirdsakafasdvllprvetdpelfhlmgqagllgvtlpe
    dygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeqrkkylpglvsg
    eligcfgltepdagsagmktraekidggyrlsgskmwisnspiadvfvvwaksaahdnai
    rgfilekgmkglsapkiggkslrasitgeivmdgvevsedailpnvsglkgpfgclnrar
    ygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmqteialgiqaslrvg
    rlfdegkmapemisivkrnncgkaldiarqardmhgeyhvmrhaqnletvntyegthdvh
    alilgraqtgiqaff